PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G093400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family Nin-like
Protein Properties Length: 400aa    MW: 42363.7 Da    PI: 5.6671
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G093400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK74.61.2e-23310359352
              RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ++++l+dl++yF+lp+++AAk+Lgvc+TvLK + R+++++RWPhRkiks+
  Sevir.3G093400.1.p 310 SNLQLSDLARYFHLPMTEAAKHLGVCATVLKTTSRRFNVPRWPHRKIKSI 359
                         79**********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.483299381IPR003035RWP-RK domain
PfamPF020423.2E-21311359IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MADGHGEGAA WEGPYDPFLM QDDFDDVMYL LDMAAVVLDP PPLAAQAQNV AAGPSPSGDN  60
NLLECPAKSN NDSVGNSAPT HNAGVTTGSP SRAQDVGAST SATASTSSPA ATHQNALDCT  120
GCQLLREVLH SNGFEATKLS IHGAAGVFYH ATLQVYRINS EGMATSLTHQ SNIDFRCRDY  180
EWVKRYLTGY AQQRAGGGYT VIHDSVSAFH DALCTRMSYG GGNVEGGDDR CEGEIMAAAA  240
VENGGGDHQH QELAGAADVA AHPPVEQGDA PAAAAAAGPS EPSADNEQEQ REVRPVGGRS  300
ALAIQRERAS NLQLSDLARY FHLPMTEAAK HLGVCATVLK TTSRRFNVPR WPHRKIKSID  360
NHVAKLRRSG GNGGAAAMSE MERLTESRRK IYADLVERE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008674154.11e-124PREDICTED: uncharacterized protein LOC103650336
TrEMBLK3ZF930.0K3ZF93_SETIT; Uncharacterized protein
STRINGSi025242m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP80552944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.13e-14RWP-RK domain-containing protein